PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00049092-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family bZIP
Protein Properties Length: 449aa    MW: 50174.1 Da    PI: 8.6119
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00049092-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.91.9e-072472901760
                       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                       A+rsR RK+++i eLe+ v +L+ae ++   e+  l+++   l+
  PSME_00049092-RA 247 AQRSRVRKLQYISELERNVSALQAEESEVSAEVTFLNQQRLILT 290
                       89*************************99999999998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0036236295IPR004827Basic-leucine zipper domain
CDDcd147037.78E-16237286No hitNo description
SuperFamilySSF579591.94E-5247289No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-7247287No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MANQMKGKTQ PVNWSYSPRQ PHLPPKSPFP SMGPAFVDYG PSPFMGQKSS PHAREGYRQH  60
QRTSSESVII EEQPSWLDDL LNEPETPVKK GSHRRSASDS VTFLEVPSAI SRVENIAEAE  120
FDRSLKYQFS RTSSDVDWID QEYRTLNSYQ AKSKKPPIRS WDASLHSGTT YKGGSNTARE  180
SRKIANLGTS SLTQDFESVT TSVVKRDDQH ECDGHDATFS GLEGRDTLHF KPDDPDVDQK  240
RTKQHFAQRS RVRKLQYISE LERNVSALQA EESEVSAEVT FLNQQRLILT LENQALKQRI  300
SGLAQEKLIK DAEHELLIKE AQRLKLLYQQ QQMQQHSSLQ PSHMHQLPTS LDFDLQQLQF  360
SKLSLGTAKP VDSKLSPSNG VFGIAKDMGG MSVVNGNDGG TTHRNGRSEV SKGNIPSSCM  420
VAGTSKKLDG RRMMTGGGLV PVDFMLQNS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1183550.0BT118355.1 Picea glauca clone GQ04005_H20 mRNA sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.23e-59bZIP family protein